PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0042s0038.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 412aa    MW: 46969 Da    PI: 10.1322
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0042s0038.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B350.73.3e-161099198
                         EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                   B3  1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92
                         ffkv t+++++++  + +p++f++ + g  +++    l  +sg++W v+l   + +++ ++t+GW+ Fvk+n ++ gDf+ Fkl+ +  f  
  Kaladp0042s0038.1.p 10 FFKVYTTEHSFNR--MKVPREFVAYMRGR-TCG-AAELAGPSGETWLVEL--VQEGKHLFFTDGWQTFVKENMVEYGDFLFFKLHCNLMF-- 93
                         8999999999975..8*******555555.565.89**************..999999*************************9875444.. PP

                         EEEEE- CS
                   B3 93 vvkvfr 98
                          v +f+
  Kaladp0042s0038.1.p 94 SVVIFD 99
                         666665 PP

2B359.84.7e-19178263897
                          -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                   B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                          s+ +  + l++p++f++e+++k e++ +++l+++++ sWev++   +++g++ l +GW  F+++n+L++gD++ F+l++  + e+ v+v 
  Kaladp0042s0038.1.p 178 SNLGLGNYLRFPRSFIRENSLKYESNEKMVLRTSNNSSWEVNI--INNGGAISLCRGWAAFARDNNLRVGDVCKFELVD--RLEMAVHVS 263
                          444555889**********99999999****************..99999**************************987..455567665 PP

3B350.63.5e-16315406196
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          f+  +++ +v +  ++ +p  f++e++    + ++++l++    sW+v+l    ++ +y + +GW +Fv++n++kegD++ F+l +  + 
  Kaladp0042s0038.1.p 315 FVACMKKYHVKRPFIMNIPTWFVRENSVRYGRLQKMVLRTNGDSSWSVNL--LHNQHKYCFCGGWADFVRDNNIKEGDSCKFELLN--RL 400
                          556677778888899***********666678889***************..777778*************************876..45 PP

                          ..EEEE CS
                   B3  91 elvvkv 96 
                          e++v++
  Kaladp0042s0038.1.p 401 EMKVHL 406
                          556665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.4E-206103IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-206103IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.2398101IPR003340B3 DNA binding domain
CDDcd100178.11E-15899No hitNo description
PfamPF023628.6E-141099IPR003340B3 DNA binding domain
SMARTSM010199.4E-1210101IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.3E-21166264IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-20170263IPR015300DNA-binding pseudobarrel domain
CDDcd100171.39E-16170262No hitNo description
PROSITE profilePS5086314.001171266IPR003340B3 DNA binding domain
SMARTSM010191.2E-13171268IPR003340B3 DNA binding domain
PfamPF023621.5E-16178262IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.4E-23309407IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.81E-22312408IPR015300DNA-binding pseudobarrel domain
CDDcd100172.22E-17313406No hitNo description
PfamPF023625.7E-14315407IPR003340B3 DNA binding domain
PROSITE profilePS5086312.788315410IPR003340B3 DNA binding domain
SMARTSM010199.7E-15315410IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MDEADNLPEF FKVYTTEHSF NRMKVPREFV AYMRGRTCGA AELAGPSGET WLVELVQEGK  60
HLFFTDGWQT FVKENMVEYG DFLFFKLHCN LMFSVVIFDE TMCEKGVALG AKCSRGRDGV  120
LEAEEVQNGA KPVKRNRVRR SLSKGIGSDL ITPDPKDRAA ERISTSVKAS FVQHIKISNL  180
GLGNYLRFPR SFIRENSLKY ESNEKMVLRT SNNSSWEVNI INNGGAISLC RGWAAFARDN  240
NLRVGDVCKF ELVDRLEMAV HVSQRHVEIR PEKVNAARSN LRPLTRAVGA SQPVLRRVGQ  300
KEAARSRPSS VKPSFVACMK KYHVKRPFIM NIPTWFVREN SVRYGRLQKM VLRTNGDSSW  360
SVNLLHNQHK YCFCGGWADF VRDNNIKEGD SCKFELLNRL EMKVHLMPRS K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.11e-20B3 family protein